RB1CC1 Antibody
| Name | RB1CC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-47312 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAETKRSTELVLSP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RB1CC1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RB1CC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: RB1CC1 Antibody [NBP2-47312] - Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8990_RB1CC1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47312-img0004.jpg)
![Immunohistochemistry-Paraffin: RB1CC1 Antibody [NBP2-47312] - Staining of human testis shows cytoplasmic positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8991_RB1CC1-Antibody-Immunohistochemistry-Paraffin-NBP2-47312-img0003.jpg)