eEF1A2 binding protein Antibody
| Name | eEF1A2 binding protein Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48962 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIYTNRFTLLGILPGHEYHFRVVA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | eEF1A2 binding protein Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IGFN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: eEF1A2 binding protein Antibody [NBP2-48962] - Analysis of human cell line HeLa shows positivity in cytokinetic bridge.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9237_eEF1A2-binding-protein-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48962-img0001.jpg)
Immunocytochemistry/Immunofluorescence: eEF1A2 binding protein Antibody [NBP2-48962] - Analysis of human cell line HeLa shows positivity in cytokinetic bridge.
![Immunohistochemistry-Paraffin: eEF1A2 binding protein Antibody [NBP2-48962] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9238_eEF1A2-binding-protein-Antibody-Immunohistochemistry-Paraffin-NBP2-48962-img0002.jpg)
Immunohistochemistry-Paraffin: eEF1A2 binding protein Antibody [NBP2-48962] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.