TUSC3 Antibody
| Name | TUSC3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48952 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:GQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFI |
| Purity/Format | Affinity purified |
| Blocking Peptide | TUSC3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TUSC3 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TUSC3 Antibody [NBP2-48952] - Analysis of human cell line RT4 shows positivity in actin filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/22453_TUSC3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48952-img0001.jpg)
Immunocytochemistry/Immunofluorescence: TUSC3 Antibody [NBP2-48952] - Analysis of human cell line RT4 shows positivity in actin filaments.