Wnt-10b Antibody

Name Wnt-10b Antibody
Supplier Novus Biologicals
Catalog NBP2-49165
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:SLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFS
Purity/Format Immunogen affinity purified
Blocking Peptide Wnt-10b Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene WNT10B
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.