PTPRD Antibody
| Name | PTPRD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49153 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PTPRD Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PTPRD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PTPRD Antibody [NBP2-49153] - Immunofluorescent staining of human cell line RH-30 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/153_PTPRD%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49153-img0003.jpg)
Immunocytochemistry/Immunofluorescence: PTPRD Antibody [NBP2-49153] - Immunofluorescent staining of human cell line RH-30 shows localization to vesicles.
![Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/154_PTPRD-Antibody-Immunohistochemistry-Paraffin-NBP2-49153-img0002.jpg)
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.