APOLD1 Antibody
| Name | APOLD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49046 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:SLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | APOLD1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | APOLD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: APOLD1 Antibody [NBP2-49046] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7838_APOLD1-Antibody-Western-Blot-NBP2-49046-img0002.jpg)
Western Blot: APOLD1 Antibody [NBP2-49046] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
![Immunohistochemistry-Paraffin: APOLD1 Antibody [NBP2-49046] - Staining of human placenta shows cytoplasmic positivity in a subset of cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7839_APOLD1-Antibody-Immunohistochemistry-Paraffin-NBP2-49046-img0003.jpg)
Immunohistochemistry-Paraffin: APOLD1 Antibody [NBP2-49046] - Staining of human placenta shows cytoplasmic positivity in a subset of cells.