SUCLG2 Antibody
| Name | SUCLG2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49029 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:AADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SUCLG2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SUCLG2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SUCLG2 Antibody [NBP2-49029] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7689_SUCLG2%2520Antibody-Western%2520Blot-NBP2-49029-img0002.jpg)
Western Blot: SUCLG2 Antibody [NBP2-49029] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
![Immunohistochemistry: SUCLG2 Antibody [NBP2-49029] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7690_SUCLG2-Antibody-Immunohistochemistry-NBP2-49029-img0001.jpg)
Immunohistochemistry: SUCLG2 Antibody [NBP2-49029] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.