IQCD Antibody
| Name | IQCD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48916 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:EIENWIQKYDTEMGEKQEELEDLDAVHREEKISLEELRRRHKVLVGEFAQIREEREINSKKRMEAEQEMVRMVRA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IQCD Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IQCD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: IQCD Antibody [NBP2-48916] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13080_IQCD-Antibody-Western-Blot-NBP2-48916-img0002.jpg)
Western Blot: IQCD Antibody [NBP2-48916] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: IQCD Antibody [NBP2-48916] - Staining of human cell line SK-MEL-30 shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13081_IQCD-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48916-img0003.jpg)
Immunocytochemistry/Immunofluorescence: IQCD Antibody [NBP2-48916] - Staining of human cell line SK-MEL-30 shows localization to nucleus.
![Immunohistochemistry: IQCD Antibody [NBP2-48916] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13082_IQCD-Antibody-Immunohistochemistry-NBP2-48916-img0001.jpg)
Immunohistochemistry: IQCD Antibody [NBP2-48916] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.