CCDC124 Antibody
| Name | CCDC124 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48858 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:LEDAYWKDDDKHVMRKEQRKEEKEKRRLDQLERKKETQRLLEEEDSKLKGGKAPRVATSSKVTRAQIEDTLRRDHQLRE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC124 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CCDC124 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CCDC124 Antibody [NBP2-48858] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7669_CCDC124%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48858-img0003.jpg)
Immunocytochemistry/Immunofluorescence: CCDC124 Antibody [NBP2-48858] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: CCDC124 Antibody [NBP2-48858] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7670_CCDC124-Antibody-Immunohistochemistry-Paraffin-NBP2-48858-img0002.jpg)
Immunohistochemistry-Paraffin: CCDC124 Antibody [NBP2-48858] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.