RAVER1 Antibody
| Name | RAVER1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48795 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:KSDLLGKPLGPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RAVER1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RAVER1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RAVER1 Antibody [NBP2-48795] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7673_RAVER1%2520Antibody-Western%2520Blot-NBP2-48795-img0002.jpg)
Western Blot: RAVER1 Antibody [NBP2-48795] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
![Immunohistochemistry: RAVER1 Antibody [NBP2-48795] - Staining of human testis shows strong cytoplasmic and nuclear positivity in spermatids.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7674_RAVER1-Antibody-Immunohistochemistry-NBP2-48795-img0001.jpg)
Immunohistochemistry: RAVER1 Antibody [NBP2-48795] - Staining of human testis shows strong cytoplasmic and nuclear positivity in spermatids.