PAPL Antibody
| Name | PAPL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48753 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:PRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERYN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PAPL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PAPL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PAPL Antibody [NBP2-48753] - Staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20560_PAPL%2520Antibody-Immunohistochemistry-Paraffin-NBP2-48753-img0002.jpg)
Immunohistochemistry-Paraffin: PAPL Antibody [NBP2-48753] - Staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.