Ataxin-2-like protein Antibody
| Name | Ataxin-2-like protein Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48790 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:LKEEPKGKEKEVDGLLTSEPMGSPVSSKTESVSDKEDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIKGED |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Ataxin-2-like protein Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ATXN2L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Ataxin-2-like protein Antibody [NBP2-48790] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7611_Ataxin-2-like%2520protein%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48790-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Ataxin-2-like protein Antibody [NBP2-48790] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
![Immunohistochemistry-Paraffin: Ataxin-2-like protein Antibody [NBP2-48790] - Staining of human Staining of human lymph node. shows strong cytoplasmic positivity in germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7612_Ataxin-2-like-protein-Antibody-Immunohistochemistry-Paraffin-NBP2-48790-img0002.jpg)
Immunohistochemistry-Paraffin: Ataxin-2-like protein Antibody [NBP2-48790] - Staining of human Staining of human lymph node. shows strong cytoplasmic positivity in germinal center cells.