L2HGDH Antibody
| Name | L2HGDH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49445 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:KKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEI |
| Purity/Format | Affinity purified |
| Blocking Peptide | L2HGDH Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | L2HGDH |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: L2HGDH Antibody [NBP2-49445] - Analysis of human cell line MCF7 shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/22660_L2HGDH%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49445-img0001.jpg)
Immunocytochemistry/Immunofluorescence: L2HGDH Antibody [NBP2-49445] - Analysis of human cell line MCF7 shows positivity in mitochondria.