SAMD4A Antibody
| Name | SAMD4A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49440 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:PTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SAMD4A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SAMD4A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SAMD4A Antibody [NBP2-49440] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoli fibrillar center & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7793_SAMD4A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49440-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SAMD4A Antibody [NBP2-49440] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoli fibrillar center & cell junctions.
![Immunohistochemistry-Paraffin: SAMD4A Antibody [NBP2-49440] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7794_SAMD4A-Antibody-Immunohistochemistry-Paraffin-NBP2-49440-img0005.jpg)
Immunohistochemistry-Paraffin: SAMD4A Antibody [NBP2-49440] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.