POLR3D Antibody
| Name | POLR3D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49530 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:LPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQE |
| Purity/Format | Affinity purified |
| Blocking Peptide | POLR3D Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | POLR3D |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: POLR3D Antibody [NBP2-49530] - Staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/22696_POLR3D%2520Antibody-Immunohistochemistry-NBP2-49530-img0001.jpg)
Immunohistochemistry: POLR3D Antibody [NBP2-49530] - Staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.