LMO4 Antibody
| Name | LMO4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49342 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:FTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LMO4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LMO4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: LMO4 Antibody [NBP2-49342] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8955_LMO4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49342-img0003.jpg)
![Immunohistochemistry-Paraffin: LMO4 Antibody [NBP2-49342] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8956_LMO4-Antibody-Immunohistochemistry-Paraffin-NBP2-49342-img0002.jpg)