TPRG1 Antibody
| Name | TPRG1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49311 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:TFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TPRG1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TPRG1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TPRG1 Antibody [NBP2-49311] - Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7724_TPRG1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49311-img0003.jpg)
Immunocytochemistry/Immunofluorescence: TPRG1 Antibody [NBP2-49311] - Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: TPRG1 Antibody [NBP2-49311] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7725_TPRG1-Antibody-Immunohistochemistry-Paraffin-NBP2-49311-img0002.jpg)
Immunohistochemistry-Paraffin: TPRG1 Antibody [NBP2-49311] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.