RPL6 Antibody

Name RPL6 Antibody
Supplier Novus Biologicals
Catalog NBP2-49552
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:NRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIF
Purity/Format Immunogen affinity purified
Blocking Peptide RPL6 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene RPL6
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.