LZTR1 Antibody
| Name | LZTR1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49649 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:HSCSDSVEYLTLNFGPFETVHRWRRLPPCDEFVGARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LZTR1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LZTR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LZTR1 Antibody [NBP2-49649] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5649_LZTR1-Antibody-Western-Blot-NBP2-49649-img0002.jpg)
Western Blot: LZTR1 Antibody [NBP2-49649] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG
![Immunocytochemistry/Immunofluorescence: LZTR1 Antibody [NBP2-49649] - Staining of human cell line U-2 OS shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5650_LZTR1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49649-img0003.jpg)
Immunocytochemistry/Immunofluorescence: LZTR1 Antibody [NBP2-49649] - Staining of human cell line U-2 OS shows localization to nucleus.
![Immunohistochemistry: LZTR1 Antibody [NBP2-49649] - Staining of human spleen shows moderate cytoplasmic positivity in subset of cells in red pulp.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5651_LZTR1-Antibody-Immunohistochemistry-NBP2-49649-img0001.jpg)
Immunohistochemistry: LZTR1 Antibody [NBP2-49649] - Staining of human spleen shows moderate cytoplasmic positivity in subset of cells in red pulp.