ARSJ Antibody
| Name | ARSJ Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48658 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ARSJ Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ARSJ |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ARSJ Antibody [NBP2-48658] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasma](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14566_ARSJ-Antibody-Western-Blot-NBP2-48658-img0002.jpg)
Western Blot: ARSJ Antibody [NBP2-48658] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasma
![Immunocytochemistry/Immunofluorescence: ARSJ Antibody [NBP2-48658] - Staining of human cell line BJ shows localization to actin filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14567_ARSJ-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48658-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ARSJ Antibody [NBP2-48658] - Staining of human cell line BJ shows localization to actin filaments.
![Immunohistochemistry: ARSJ Antibody [NBP2-48658] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14568_ARSJ-Antibody-Immunohistochemistry-NBP2-48658-img0001.jpg)
Immunohistochemistry: ARSJ Antibody [NBP2-48658] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.