PCDHA12 Antibody
| Name | PCDHA12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48645 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:LNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGIPSMAGHSMVLVEV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PCDHA12 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PCDHA12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: PCDHA12 Antibody [NBP2-48645] - Staining of human cell line A549 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7559_PCDHA12-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48645-img0003.jpg)
![Immunohistochemistry-Paraffin: PCDHA12 Antibody [NBP2-48645] - Staining of human cerebellum shows cytoplasmic positivity in purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7560_PCDHA12-Antibody-Immunohistochemistry-Paraffin-NBP2-48645-img0002.jpg)