SLFN12 Antibody

Name SLFN12 Antibody
Supplier Novus Biologicals
Catalog NBP2-48557
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:NRVMQLTRKEWIQFMVEAEPKFSSSYEEVISQINTSLPAPHSWPLLEWQRQRHHCPGLSGRITYTP
Purity/Format Immunogen affinity purified
Blocking Peptide SLFN12 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SLFN12L
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.