KLHDC9 Antibody
| Name | KLHDC9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48547 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:QEGCHTASRSGHCAALLQTPGPHPGHQLLLFGGCNLAEPEVAGHWSHGKIKEEPPVAPHLMEQLARLVSSGQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KLHDC9 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KLHDC9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: KLHDC9 Antibody [NBP2-48547] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407615)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7579_KLHDC9%2520Antibody-Western%2520Blot-NBP2-48547-img0002.jpg)
Western Blot: KLHDC9 Antibody [NBP2-48547] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407615)
![Immunohistochemistry: KLHDC9 Antibody [NBP2-48547] - Staining of human esophagus shows moderate nuclear/nucleolar positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7580_KLHDC9-Antibody-Immunohistochemistry-NBP2-48547-img0001.jpg)
Immunohistochemistry: KLHDC9 Antibody [NBP2-48547] - Staining of human esophagus shows moderate nuclear/nucleolar positivity in squamous epithelial cells.