FAM213A Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-48573
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids:KFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEK
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: FAM213A Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: FAM213A
• Conjugate: Unconjugated

Product images

Western Blot: FAM213A Antibody [NBP2-48573] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunohistochemistry-Paraffin: FAM213A Antibody [NBP2-48573] - Staining of human breast shows moderate cytoplasmic positivity in adipocytes.

Western Blot: FAM213A Antibody [NBP2-48573] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp