R9AP Antibody
| Name | R9AP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48946 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:LDGLNKTTACYHHLVLTVGGSADSQDLRQELQKTRQKAQELAVSTCARLTAVLRDRGLAADERAEFERLWVAFSGCLDLLEAD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | R9AP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RGS9BP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: R9AP Antibody [NBP2-48946] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2309_R9AP%2520Antibody-Immunohistochemistry-NBP2-48946-img0001.jpg)
Immunohistochemistry: R9AP Antibody [NBP2-48946] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.