Annexin 2 Receptor Antibody
| Name | Annexin 2 Receptor Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49008 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:EYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Annexin 2 Receptor Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ANXA2R |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Annexin 2 Receptor Antibody [NBP2-49008] - Staining of human cell line HUVEC TERT2 shows localization to nucleoplasm, cytosol & cytoplasmic bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7603_Annexin-2-Receptor-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49008-img0002.jpg)
Immunocytochemistry/Immunofluorescence: Annexin 2 Receptor Antibody [NBP2-49008] - Staining of human cell line HUVEC TERT2 shows localization to nucleoplasm, cytosol & cytoplasmic bodies.
![Immunohistochemistry: Annexin 2 Receptor Antibody [NBP2-49008] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7604_Annexin-2-Receptor-Antibody-Immunohistochemistry-NBP2-49008-img0001.jpg)
Immunohistochemistry: Annexin 2 Receptor Antibody [NBP2-49008] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.