GPR12 Antibody
| Name | GPR12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48989 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GPR12 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GPR12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: GPR12 Antibody [NBP2-48989] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3723_GPR12%2520Antibody-Immunohistochemistry-NBP2-48989-img0001.jpg)
Immunohistochemistry: GPR12 Antibody [NBP2-48989] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.