SLC8A2 Antibody

Name SLC8A2 Antibody
Supplier Novus Biologicals
Catalog NBP2-48980
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:PANDSDTSTGGCQGSYRCQPGVLLPVWEPDDPSLGDKAA
Purity/Format Immunogen affinity purified
Blocking Peptide SLC8A2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SLC8A2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.