SAT2 Antibody
| Name | SAT2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49244 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:LRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SAT2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SAT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SAT2 Antibody [NBP2-49244] - Staining of human kidney shows cytoplasmic and nuclear positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3718_SAT2%2520Antibody-Immunohistochemistry-NBP2-49244-img0001.jpg)
Immunohistochemistry: SAT2 Antibody [NBP2-49244] - Staining of human kidney shows cytoplasmic and nuclear positivity in cells in tubules.