C9orf64 Antibody
| Name | C9orf64 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49155 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:QDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDVSMPLVEERHRILNETGKILLEKFGGS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C9orf64 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C9orf64 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: C9orf64 Antibody [NBP2-49155] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1456_C9orf64-Antibody-Immunohistochemistry-NBP2-49155-img0001.jpg)
Immunohistochemistry: C9orf64 Antibody [NBP2-49155] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.