NT5C1A Antibody
| Name | NT5C1A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49121 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:DQMFHVAGAQEMGTVAAHVPYGVAQTPRRTAPAKQA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NT5C1A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NT5C1A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: NT5C1A Antibody [NBP2-49121] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2731_NT5C1A%2520Antibody-Immunohistochemistry-Paraffin-NBP2-49121-img0002.jpg)
Immunohistochemistry-Paraffin: NT5C1A Antibody [NBP2-49121] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.