TMPRSS11E Antibody
| Name | TMPRSS11E Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48995 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TMPRSS11E Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TMPRSS11E |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: TMPRSS11E Antibody [NBP2-48995] - Staining of human esophagus shows moderate membranous positivity in superficial layer of squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2411_TMPRSS11E%2520Antibody-Immunohistochemistry-NBP2-48995-img0001.jpg)
Immunohistochemistry: TMPRSS11E Antibody [NBP2-48995] - Staining of human esophagus shows moderate membranous positivity in superficial layer of squamous epithelial cells.