ILT7/CD85g/LILRA4 Antibody

Name ILT7/CD85g/LILRA4 Antibody
Supplier Novus Biologicals
Catalog NBP2-48932
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD
Purity/Format Immunogen affinity purified
Blocking Peptide ILT7/CD85g/LILRA4 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene LILRA4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.