CEP78 Antibody

Name CEP78 Antibody
Supplier Novus Biologicals
Catalog NBP2-48920
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:ALETNTTLVVLDIRKNPLIDHSMMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIGLATKKPVSSGRK
Purity/Format Immunogen affinity purified
Blocking Peptide CEP78 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CEP78
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.