ILT7/CD85g/LILRA4 Antibody
| Name | ILT7/CD85g/LILRA4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48898 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:GYRLDKEGNSMSRHILKTLESENKVKLSIPSMMWEHAGRY |
| Purity/Format | Affinity purified |
| Blocking Peptide | ILT7/CD85g/LILRA4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LILRA4 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ILT7/CD85g/LILRA4 Antibody [NBP2-48898] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/23279_ILT7-CD85g-LILRA4%2520Antibody-Immunohistochemistry-NBP2-48898-img0001.jpg)
Immunohistochemistry: ILT7/CD85g/LILRA4 Antibody [NBP2-48898] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.