PATZ Antibody
| Name | PATZ Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48884 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:LLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PATZ Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PATZ1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PATZ Antibody [NBP2-48884] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7619_PATZ-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48884-img0002.jpg)
Immunocytochemistry/Immunofluorescence: PATZ Antibody [NBP2-48884] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.
![Immunohistochemistry: PATZ Antibody [NBP2-48884] - Staining of human kidney shows strong nuclear and cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7620_PATZ-Antibody-Immunohistochemistry-NBP2-48884-img0001.jpg)
Immunohistochemistry: PATZ Antibody [NBP2-48884] - Staining of human kidney shows strong nuclear and cytoplasmic positivity in cells in tubules.