EAAT4 Antibody
| Name | EAAT4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48805 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:MSSHGNSLFLRESGQRLGRVGWLQRLQESLQQRALRTRLRLQTMTLEHVLRFLRRN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EAAT4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC1A6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: EAAT4 Antibody [NBP2-48805] - Staining of human cell line U-2 OS shows localization to intermediate filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7555_EAAT4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48805-img0002.jpg)
![Immunohistochemistry: EAAT4 Antibody [NBP2-48805] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7556_EAAT4-Antibody-Immunohistochemistry-NBP2-48805-img0001.jpg)