C1orf185 Antibody
| Name | C1orf185 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48767 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:CKRREIFQNSKFKAIDERCRQRPSMAKIKSHSQCVFISRNFHTGRFQLQEE |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C1orf185 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: C1orf185 Antibody [NBP2-48767] - Staining of human kidney shows moderate nuclear positivity in cells in tubules and cells in glomeruli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/23354_C1orf185%2520Antibody-Immunohistochemistry-NBP2-48767-img0001.jpg)
Immunohistochemistry: C1orf185 Antibody [NBP2-48767] - Staining of human kidney shows moderate nuclear positivity in cells in tubules and cells in glomeruli.