ABCC10 Antibody
| Name | ABCC10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48831 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:ILGMLSYTTRLLCTHRTEYLERADAVLLMEAGRLIRAGPPSEILPLVQAVPKAWAENGQESDSATAQSVQNPEKTKEGLEEEQSTSGRLLQEESKKE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ABCC10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ABCC10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ABCC10 Antibody [NBP2-48831] - Staining of human prostate shows membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/708_ABCC10%2520Antibody-Immunohistochemistry-NBP2-48831-img0001.jpg)
Immunohistochemistry: ABCC10 Antibody [NBP2-48831] - Staining of human prostate shows membranous positivity in glandular cells.