CESK1 Antibody
| Name | CESK1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48829 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:EGIINVAQEGVWDTLIVKAQGFRAVAEVVLQLVTVDEIVVAKK |
| Purity/Format | Affinity purified |
| Blocking Peptide | CESK1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CCT8L2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CESK1 Antibody [NBP2-48829] - Staining of human kidney shows strong granular cytoplasmic positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/23372_CESK1%2520Antibody-Immunohistochemistry-NBP2-48829-img0001.jpg)
Immunohistochemistry: CESK1 Antibody [NBP2-48829] - Staining of human kidney shows strong granular cytoplasmic positivity in renal tubules.