PPM1J Antibody
| Name | PPM1J Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13797 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPND HSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PPM1J Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PPM1J |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PPM1J Antibody [NBP2-13797] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4693_PPM1J%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13797-img0002.jpg)
Immunohistochemistry-Paraffin: PPM1J Antibody [NBP2-13797] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.