FNDC4 Antibody
| Name | FNDC4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49397 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:PPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FNDC4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FNDC4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: FNDC4 Antibody [NBP2-49397] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8965_FNDC4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49397-img0002.jpg)
![Immunohistochemistry: FNDC4 Antibody [NBP2-49397] - Staining of human kidney shows strong cytoplasmic and membranous positivity in subset of cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8966_FNDC4-Antibody-Immunohistochemistry-NBP2-49397-img0001.jpg)