Plakophilin-3 Antibody
| Name | Plakophilin-3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49379 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:FDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSDAAAKKQARSLQAVPRLVKLFNHANQEVQRHATGAMRNLI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Plakophilin-3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PKP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Plakophilin-3 Antibody [NBP2-49379] - Staining of human cell line A-431 shows localization to nucleoplasm & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7726_Plakophilin-3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49379-img0002.jpg)
Immunocytochemistry/Immunofluorescence: Plakophilin-3 Antibody [NBP2-49379] - Staining of human cell line A-431 shows localization to nucleoplasm & cell junctions.
![Immunohistochemistry: Plakophilin-3 Antibody [NBP2-49379] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7727_Plakophilin-3-Antibody-Immunohistochemistry-NBP2-49379-img0001.jpg)
Immunohistochemistry: Plakophilin-3 Antibody [NBP2-49379] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.