SP-B/Surfactant Protein B Antibody
| Name | SP-B/Surfactant Protein B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49359 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:PLVIDYFQNQIDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SP-B/Surfactant Protein B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SFTPB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Surfactant Protein B Antibody [NBP2-49359] - Staining of human lung shows moderate cytoplasmic positivity in subset of pneumocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3408_Surfactant%2520Protein%2520B%2520Antibody-Immunohistochemistry-NBP2-49359-img0001.jpg)
Immunohistochemistry: Surfactant Protein B Antibody [NBP2-49359] - Staining of human lung shows moderate cytoplasmic positivity in subset of pneumocytes.