GABA-B R2 Antibody

Name GABA-B R2 Antibody
Supplier Novus Biologicals
Catalog NBP2-49520
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:STLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSR
Purity/Format Immunogen affinity purified
Blocking Peptide GABA-B R2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene GABBR2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.