CELSR1 Antibody
| Name | CELSR1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49512 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:PTSFRLQILNNYLQFEVSHGPSDVESVMLSGLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDYGMDQNKADIGGMLPGLTVRSVVV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CELSR1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CELSR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CELSR1 Antibody [NBP2-49512] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3274_CELSR1%2520Antibody-Immunohistochemistry-NBP2-49512-img0001.jpg)
Immunohistochemistry: CELSR1 Antibody [NBP2-49512] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.