CD96 Antibody
| Name | CD96 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49491 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:VPGNKVWNISSEKITFLLGSEISSTDPPLSVTESTLDTQPSPASSVSPARYPATSSVTLVDVSALRPNTTPQPSNSSMTT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CD96 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CD96 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: CD96 Antibody [NBP2-49491] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17041_CD96-Antibody-Immunohistochemistry-Paraffin-NBP2-49491-img0002.jpg)
Immunohistochemistry-Paraffin: CD96 Antibody [NBP2-49491] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.