CCER1 Antibody
| Name | CCER1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49487 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:GCGCGWAHSASLSSWSSCHRRRPGAPAYNRPHRYSPKTEYGPPRKQPKQQH |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CCER1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CCER1 Antibody [NBP2-49487] - Staining of human oral mucosa shows moderate nuclear and cytoplasmic membranous positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/23640_CCER1%2520Antibody-Immunohistochemistry-NBP2-49487-img0001.jpg)
Immunohistochemistry: CCER1 Antibody [NBP2-49487] - Staining of human oral mucosa shows moderate nuclear and cytoplasmic membranous positivity in squamous epithelial cells.