Proline-Rich Basic Protein 1 Antibody

Name Proline-Rich Basic Protein 1 Antibody
Supplier Novus Biologicals
Catalog NBP2-49310
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids:VKTTYAPGFPAGAQGSGLPAPPADPCGEEGGESKTQEPPALGPPAPAHYTSVFIKDFLPVVPHPYEPPEPS
Purity/Format Immunogen affinity purified
Blocking Peptide Proline-Rich Basic Protein 1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene PROB1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.