MAP7D2 Antibody
| Name | MAP7D2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-49300 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids:PLNPSYKSSPTRNIEKKKATSTSTSGAGDVGKEALSGGEASLVEKVKRGQRTATSLPVVNFGSPLRRCEFSGGIPKRPSSPVI |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MAP7D2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: MAP7D2 Antibody [NBP2-49300] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2313_MAP7D2%2520Antibody-Immunohistochemistry-NBP2-49300-img0001.jpg)
Immunohistochemistry: MAP7D2 Antibody [NBP2-49300] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.